{"product_id":"proteintech-32710-1-ap","title":"Proteintech, 32710-1-AP, UCP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UCP1 (32710-1-AP) by Proteintech is a Polyclonal antibody targeting UCP1 in WB, IHC, ELISA applications with reactivity to mouse samples\n32710-1-AP targets UCP1 in WB, IHC, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brown adipose tissue\nPositive IHC detected in: mouse brown adipose tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUCP-1 (Mitochondrial uncoupling protein 1), is a mitochondrial transporter protein that creates proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. It has been identified a key molecule for metabolic thermogenesis to avoid an excess of fat accumulation. UCP-1 expression is usually restricted to brown adipose when induced by cold exposure and thyroid hormone.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38217 Product name: Recombinant mouse Ucp1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 97-178 aa of BC012701 Sequence: DSVQEYFSSGRETPASLGNKISAGLMTGGVAVFIGQPTEVVKVRMQAQSHLHGIKPRYTGTYNAYRVIATTESLSTLWKGTT Predict reactive species\nFull Name: uncoupling protein 1 (mitochondrial, proton carrier)\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC012701\nGene Symbol: Ucp1\nGene ID (NCBI): 22227\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P12242\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887916339369,"sku":"32710-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32710-1-ap","provider":"Iright","version":"1.0","type":"link"}