{"product_id":"proteintech-32720-1-ap","title":"Proteintech, 32720-1-AP, FAM69C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM69C (32720-1-AP) by Proteintech is a Polyclonal antibody targeting FAM69C in WB, ELISA applications with reactivity to human, mouse, rat samples\n32720-1-AP targets FAM69C in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse retina tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM69C is a kinase critically involved in neurodegenerative dementia. Biochemical analyses uncover that FAM69C is a serine\/threonine kinase. Phosphoproteomic characterizations reveal that FAM69C substrates are involved in synaptic structure and function. Reduced levels of FAM69C are found in postmortem brains of Alzheimer's disease patients. FAM69C is a protective regulator of memory and a potential therapeutic target for memory loss in neurodegenerative dementia (PMID: 35858575). FAM69C undergoes glycosylation modification, and a 55 kDa band was observed in the literature (PMID: 35858575). The mouse FAM69C has two isoforms, and the predicted molecular weight is 46 kDa and 30 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37611 Product name: Recombinant human DIPK1C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 300-419 aa of NM_001044369 Sequence: MAFFEPKMREILEQNCTGDEDCNFFDCFSRCDLRVNKCGAQRVNNNLQVICDKIFRHWFSAPLKSSAVSFQLQLQLQEAVQECADPGVPSGNTRRAASSVFWKLRQLLQATLRELQEAEK Predict reactive species\nFull Name: chromosome 18 open reading frame 51\nCalculated Molecular Weight: 46 kDa\nObserved Molecular Weight: 46 kDa, 55 kDa, 32 kDa\nGenBank Accession Number: NM_001044369\nGene Symbol: C18orf51\nGene ID (NCBI): 125704\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q0P6D2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887633420457,"sku":"32720-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32720-1-ap","provider":"Iright","version":"1.0","type":"link"}