{"product_id":"proteintech-32722-1-ap","title":"Proteintech, 32722-1-AP, UBXN7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UBXN7 (32722-1-AP) by Proteintech is a Polyclonal antibody targeting UBXN7 in WB, ELISA applications with reactivity to human samples\n32722-1-AP targets UBXN7 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, RT-4 cells,  U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUBXN7(UBX domain protein 7) is a protein with ubiquitin-binding activity and ubiquitin-proteasome-binding activity. It contains four different domains, namely, the N-terminal UBA domain, the UAS domain, the Ubiquitin Interaction motif (UIM) and the C-terminal UBX domain. The level of UBXN7 will affect the metabolic state of cells. High levels of UBXN7 and HIF-1α accumulation support glycolysis, while inactivation of UBXN7 and activation of NRF2 increase oxidative phosphorylation (PMID: 33444648).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38516 Product name: Recombinant human UBXN7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-200 aa of NM_015562.1 Sequence: LDGGGIAEEPSTSSASVSTVRPHTEEEVRAPIPQKQEILVEPEPLFGAPKRRRPARSIFDGFRDFQTETIRQEQELRNGGAIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQCLNRDVWSNEAVKNIIREH Predict reactive species\nFull Name: UBX domain protein 7\nCalculated Molecular Weight: 55kDa，489aa\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: NM_015562.1\nGene Symbol: UBXN7\nGene ID (NCBI): 26043\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O94888\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887916011689,"sku":"32722-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32722-1-ap","provider":"Iright","version":"1.0","type":"link"}