{"product_id":"proteintech-32764-1-ap","title":"Proteintech, 32764-1-AP, ATP1B1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATP1B1 (32764-1-AP) by Proteintech is a Polyclonal antibody targeting ATP1B1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n32764-1-AP targets ATP1B1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: fetal human brain tissue, mouse brain tissue,  mouse liver tissue,  rat brain tissue,  rat heart tissue,  mouse heart tissue\nPositive IHC detected in: mouse liver tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATP1B1 is one of beta subunits of the Na+\/K+ ATPase and responsible for formation and structural integrity of the Na+\/K+ ATPase. The Na+\/K+ ATPase is a plasma membrane pump consisting of alpha, beta, and gamma subunits. At least four of Na+\/K+-ATPase beta subunits (β1, β2, β3, β4) have been identified in mammalian cells; the β1-subunit (ATP1B1) is the most ubiquitous. The Na+\/K+ ATPase β subunits have multiple N-glycosylation sites. The predicted MW of ATP1B1 is 35 kDa, while it migrates around 40-52 kDa due to the variable glycosylation. (PMID: 10896885, 17714085)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg3007 Product name: Recombinant Mouse Atp1b1 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 63-304 aa of NM_009721.6 Sequence: ELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYREGKPCIIIKLNRVLGFKPKPPKNESLETYPLMMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGYYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTVDTEIRVECKAYGENIGYSEKDRFQGRFDVKIEIKS Predict reactive species\nFull Name: ATPase, Na+\/K+ transporting, beta 1 polypeptide\nCalculated Molecular Weight: 35 kDa\nObserved Molecular Weight: 40-50 kDa\nGenBank Accession Number: NM_009721.6\nGene Symbol: Atp1b1\nGene ID (NCBI): 11931\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P14094\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885106647209,"sku":"32764-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32764-1-ap","provider":"Iright","version":"1.0","type":"link"}