{"product_id":"proteintech-32767-1-ap","title":"Proteintech, 32767-1-AP, C5a Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C5a (32767-1-AP) by Proteintech is a Polyclonal antibody targeting C5a in WB, IHC, ELISA applications with reactivity to mouse samples\n32767-1-AP targets C5a in WB, IHC, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse serum\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe complement system is an important effector that bridges the innate and adaptive immune systems. The fifth component of complement, C5, is part of the complement cascade and plays an important role in inflammation and cell killing. It consists of disulfide-linked alpha and beta polypeptide chains but can be cleaved into two active peptides (C5a and C5b) by C5 convertases. Mutations and defects in C5 are associated with severe recurrent infections\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg3332 Product name: Recombinant Mouse C5 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 679-755 aa of NM_010406.2 Sequence: NLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGR Predict reactive species\nFull Name: hemolytic complement\nCalculated Molecular Weight: 189kDa\nObserved Molecular Weight: 110-120 kDa\nGenBank Accession Number: NM_010406.2\nGene Symbol: Hc\nGene ID (NCBI): 15139\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P06684\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885620252841,"sku":"32767-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32767-1-ap","provider":"Iright","version":"1.0","type":"link"}