{"product_id":"proteintech-32790-1-ap","title":"Proteintech, 32790-1-AP, FDX1L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FDX1L (32790-1-AP) by Proteintech is a Polyclonal antibody targeting FDX1L in WB, ELISA applications with reactivity to human, mouse, rat samples\n32790-1-AP targets FDX1L in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue, rat skeletak muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFDX1L (ferredoxin 1-like) is a gene encoding mitochondrial protein whose primary function is to participate in the biosynthesis of iron-sulfur clusters (Fe-S clusters). FDX1L is closely related to the assembly of iron-sulfur clusters and is the second component in the biosynthesis mechanism of iron-sulfur clusters. Studies have shown that FDX1L is widely expressed in human cells, especially in the central nervous system. In addition, mutations in FDX1L can lead to mitochondrial myopathy, manifested by a significant reduction in the activity of respiratory chain complexes I, II, and III. The function of FDX1L is different from that of FDX1 (ferredoxin 1). FDX1 is mainly involved in the synthesis of steroid hormones, while FDX1L focuses on the biosynthesis of iron-sulfur clusters. This functional difference allows FDX1L to play an important role in maintaining homeostasis of iron-sulfur clusters in the cell.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37104 Product name: Recombinant human FDX1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 80-183 aa of BC063460 Sequence: IPVSGRVGDNVLHLAQRHGVDLEGACEASLACSTCHVYVSEDHLDLLPPPEEREDDMLDMAPLLQENSRLGCQIVLTPELEGAEFTLPKITRNFYVDGHVPKPH Predict reactive species\nFull Name: ferredoxin 1-like\nCalculated Molecular Weight: 183 aa, 20 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC063460\nGene Symbol: FDX1L\nGene ID (NCBI): 112812\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q6P4F2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887638171817,"sku":"32790-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32790-1-ap","provider":"Iright","version":"1.0","type":"link"}