{"product_id":"proteintech-32800-1-ap","title":"Proteintech, 32800-1-AP, ELL2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ELL2 (32800-1-AP) by Proteintech is a Polyclonal antibody targeting ELL2 in WB, ELISA applications with reactivity to human samples\n32800-1-AP targets ELL2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nELL2 (Elongation Factor for RNA Polymerase II 2) is a key transcriptional elongation factor that regulates RNA polymerase II (Pol II) during mRNA synthesis (PMID: 34265249). It belongs to the ELL gene family, which includes ELL1, ELL2, and ELL3, and plays a crucial role in controlling the elongation phase of transcription (PMID: 9108030). ELL2 is an androgen-responsive gene that is expressed by prostate epithelial cells and is frequently down-regulated in prostate cancer (PMID: 29179998). The predicted molecular weight of the ELL2 protein is 72 kDa, but due to post-translational modifications, its molecular weight is approximately 90 kDa. (PMID: 39582094, PMID: 34948391)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag39224 Product name: Recombinant human ELL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 393-515 aa of BC028412 Sequence: NSNSNSPSTPEGRGTQDLPVDSFSQNDSIYEDQQDKYTSRTSLETLPPGSVLLKCPKPMEENHSMSHKKSKKKSKKHKEKDQIKKHDIETIEEKEEDLKREEEIAKLNNSSPNSSGGVKEDCT Predict reactive species\nFull Name: elongation factor, RNA polymerase II, 2\nCalculated Molecular Weight: 640 aa, 72 kDa\nObserved Molecular Weight: 80-90 kDa\nGenBank Accession Number: BC028412\nGene Symbol: ELL2\nGene ID (NCBI): 22936\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00472\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887498809513,"sku":"32800-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32800-1-ap","provider":"Iright","version":"1.0","type":"link"}