{"product_id":"proteintech-32839-1-ap","title":"Proteintech, 32839-1-AP, PGBD2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PGBD2 (32839-1-AP) by Proteintech is a Polyclonal antibody targeting PGBD2 in WB, ELISA applications with reactivity to human samples\n32839-1-AP targets PGBD2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, MDA-MB-231 cells,  Raji cells,  MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. The exact function of this gene is not known. Two transcript variants encoding different isoforms have been found for this gene.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38500 Product name: Recombinant human PGBD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of NM_170725.2 Sequence: MASTSRDVIAGRGIHSKVKSAKLLEVLNAMEEEESNNNREEIFIAPPDNAAGEFTDEDSGDEDSQRGAHLPGSVLHASVLCEDSGTGEDNDDLELQPAKKRQKAVVKPQRIWTKRDIRPDFGSWTASDPHIEDLKSQELSPVGLFELFFD Predict reactive species\nFull Name: piggyBac transposable element derived 2\nCalculated Molecular Weight: 68kDa，592aa\nObserved Molecular Weight: 71 kDa\nGenBank Accession Number: NM_170725.2\nGene Symbol: PGBD2\nGene ID (NCBI): 267002\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q6P3X8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887757775017,"sku":"32839-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32839-1-ap","provider":"Iright","version":"1.0","type":"link"}