{"product_id":"proteintech-32844-1-ap","title":"Proteintech, 32844-1-AP, RNPS1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RNPS1 (32844-1-AP) by Proteintech is a Polyclonal antibody targeting RNPS1 in WB, IP, ELISA applications with reactivity to human samples\n32844-1-AP targets RNPS1 in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, Raji cells,  Ramos cells,  fetal human brain tissue\nPositive IP detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe splicing process of mRNA must be highly precise to carry the correct genetic information to the cytoplasm as templates for translation. And this process involves more than 50 proteins in the splicing complex. RNPS1 is a versatile factor that regulates alternative splicing of a number of pre-mRNAs. It participates in both constitutive splicing and in distinctive modulation of alternative splicing in a substrate dependent manner, and involved in UPF2-dependent nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Its ser-53 phosphorylation site is important for splicing and translation stimulation activity in vitro. The molecular weight observed is consistent with what has been described in the literature (PMID: 39687031\/PMID: 10449421).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37888 Product name: Recombinant human RNPS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 158-239 aa of BC001838 Sequence: PKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVL Predict reactive species\nFull Name: RNA binding protein S1, serine-rich domain\nCalculated Molecular Weight: 34 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC001838\nGene Symbol: RNPS1\nGene ID (NCBI): 10921\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15287\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887787233449,"sku":"32844-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32844-1-ap","provider":"Iright","version":"1.0","type":"link"}