{"product_id":"proteintech-32898-1-ap","title":"Proteintech, 32898-1-AP, KCTD4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KCTD4 (32898-1-AP) by Proteintech is a Polyclonal antibody targeting KCTD4 in WB, ELISA applications with reactivity to human, mouse, rat samples\n32898-1-AP targets KCTD4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe family of potassium channel tetramerization domain (KCTD) proteins consists of 26 members (PMID: 24268103). Potassium channel tetramerization domain containing 4 (KCTD4) is a protein that interacts with CLIC1 to disrupt calcium homeostasis and promote metastasis in esophageal cancer. KCTD4 expression is upregulated in metastatic esophageal squamous cell carcinoma (ESCC), and high KCTD4 expression is associated with poor prognosis in patients with ESCC. This process activates fibroblasts in a paracrine manner, promoting cancer cell invasion via MMP24 signaling as positive feedback (PMID: 37799381).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37112 Product name: Recombinant human KCTD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-259 aa of BC018063 Sequence: MERKINRREKEKEYEGKHNSLEDTDQGKNCKSTLMTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCPFDADGHYFIDRDGLLFRHVLNFLRNGELLLPEGFRENQLLAQEAEFFQLKGLAEEVKSRWEKEQLTPRETTFLEITDNHDRSQGLRIFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSISSNIIRFKYFIKSENGTRLVLKEDNTFVCTLETLKFEAIMMALKCGFRLLTSLDCSKGSIVHSDALHFIK Predict reactive species\nFull Name: potassium channel tetramerisation domain containing 4\nCalculated Molecular Weight: 30 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC018063\nGene Symbol: KCTD4\nGene ID (NCBI): 386618\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8WVF5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887693189289,"sku":"32898-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32898-1-ap","provider":"Iright","version":"1.0","type":"link"}