{"product_id":"proteintech-32914-1-ap","title":"Proteintech, 32914-1-AP, SFT2D2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SFT2D2 (32914-1-AP) by Proteintech is a Polyclonal antibody targeting SFT2D2 in WB, ELISA applications with reactivity to human samples\n32914-1-AP targets SFT2D2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, Calu-1 cells,  HeLa cells,  MCF-7 cells\nPositive IP detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSFT2D2 is part of the SFT2 protein family, which is involved in managing membrane traffic inside cells. Its specific molecular role is linked to the Golgi apparatus, a central hub for processing and sorting proteins.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36996 Product name: Recombinant human SFT2D2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-63 aa of BC068098 Sequence: MDKLKKVLSGQDTEDRSGLSEVVEASSLSWSTRIKGFIACFAIGILCSLLGTVLLWVPRKGLH Predict reactive species\nFull Name: SFT2 domain containing 2\nCalculated Molecular Weight: 160 aa, 18 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC068098\nGene Symbol: SFT2D2\nGene ID (NCBI): 375035\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O95562\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887799226537,"sku":"32914-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32914-1-ap","provider":"Iright","version":"1.0","type":"link"}