{"product_id":"proteintech-32926-1-ap","title":"Proteintech, 32926-1-AP, CTNNAL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CTNNAL1 (32926-1-AP) by Proteintech is a Polyclonal antibody targeting CTNNAL1 in WB, ELISA applications with reactivity to human samples\n32926-1-AP targets CTNNAL1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, HepG2 cells,  HeLa cells,  L02 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCatenin alpha-like protein 1 (CTNNAL1, also known as alpha-catulin) is a cytoplasmic molecule that integrates the crosstalk between nuclear factor-kappa B (NF-κB) and Rho signaling pathways. It plays a crucial role in maintaining epithelial integrity and promoting wound repair in bronchial epithelial cells. CTNNAL1 has been shown to inhibit ozone-induced airway epithelial-mesenchymal transition and regulate mucus hypersecretion induced by house dust mite (HDM) (PMID: 38602002). Additionally, CTNNAL1 promotes the structural integrity of bronchial epithelial cells through the RhoA\/ROCK1 pathway (PMID: 36535402). In cancer, CTNNAL1 regulates cancer stem cells (CSCs) in lung cancer and glioblastoma, modulating their migration and invasion abilities (PMID: 37239133).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38629 Product name: Recombinant human CTNNAL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 290-535 aa of NM_003798 Sequence: ISIFTGIKEFKMNIEALRENLYFQSKENLSVTLEVILERMEDFTDSAYTSHEHRERILELSTQARMELQQLISVWIQAQSKKTKSIAEELELSILKISHSLNELKKELHSTATQLAADLLKYHADHVVLKALKLTGVEGNLEALAEYACKLSEQKEQLVETCRLLRHISGTEPLEITCIHAEETFQVTGQQIISAAETLTLHPSSKIAKENLDVFCEAWESQISDMSTLLREINDVFEGRRGEKYG Predict reactive species\nFull Name: catenin (cadherin-associated protein), alpha-like 1\nCalculated Molecular Weight: 82 kDa\nObserved Molecular Weight: 82 kDa\nGenBank Accession Number: NM_003798\nGene Symbol: CTNNAL1\nGene ID (NCBI): 8727\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9UBT7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886930317481,"sku":"32926-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32926-1-ap","provider":"Iright","version":"1.0","type":"link"}