{"product_id":"proteintech-32928-1-ap","title":"Proteintech, 32928-1-AP, CIR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CIR (32928-1-AP) by Proteintech is a Polyclonal antibody targeting CIR in WB, ELISA applications with reactivity to human, mouse samples\n32928-1-AP targets CIR in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse heart tissue,  mouse liver tissue,  mouse pancreas tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCIR, a protein originally identified as a CBF1-interacting protein and reported to act as a transcriptional corepressor. CIR is a member of the family of SR-related proteins and that CIR plays a role in splicing regulation. In addition to a basic lysine and acidic serine-rich (BA) domain and a zinc knuckle-like motif, CIR has an arginine\/serine dipeptide repeat (RS) domain in its C terminal region.  The RS domain has been reported to be present in the superfamily of SR proteins, which are involved in splicing reactions (PMID: 15652350).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38647 Product name: Recombinant human CIR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-160 aa of NM_004882.3 Sequence: MGKSFANFMCKKDFHPASKSNIKKVWMAEQKISYDKKKQEELMQQYLKEQESYDNRLLMGDERVKNGLNFMYEAPPGAKKENKEKEETEGETEYKFEWQKGAPREKYAKDDMNIRDQPFGIQVRNVRCIKCHKWGHVNTDRECPLFGLSGINASSVPTDG Predict reactive species\nFull Name: CBF1 interacting corepressor\nCalculated Molecular Weight: 52kDa，450aa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: NM_004882.3\nGene Symbol: CIR\nGene ID (NCBI): 9541\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q86X95\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886583042217,"sku":"32928-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32928-1-ap","provider":"Iright","version":"1.0","type":"link"}