{"product_id":"proteintech-32969-1-ap","title":"Proteintech, 32969-1-AP, ADAM23 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADAM23 (32969-1-AP) by Proteintech is a Polyclonal antibody targeting ADAM23 in WB, ELISA applications with reactivity to human, mouse, rat samples\n32969-1-AP targets ADAM23 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue,  rat cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADAM23 (A disintegrin and metalloprotease protein 23), also known as MDC-3 (Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3) is a transmembrane type I glycoprotein\ninvolved with the development and maintenance of the nervous system, including neurite outgrowth, neuronal adhesion and differentiation and regulation of synaptic transmission. In addition, ADAM23 seems to participate in immune response and tumor establishment through interaction with different members of integrin receptors (PMID: 19692335). Two forms of ADAM23 have been previously described in primary cerebellar granule cells as an unprocessed precursor (100 kDa) and mature (70 kDa) protein, respectively (PMID: 29792904).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35744 Product name: Recombinant human ADAM23 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 342-488 aa of BC132765 Sequence: NTRVVLVAVETWTEKDQIDITTNPVQMLHEFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYGLPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSILEYRDFLQRGG Predict reactive species\nFull Name: ADAM metallopeptidase domain 23\nCalculated Molecular Weight: 832 aa, 92 kDa\nObserved Molecular Weight: 92 kDa, 70 kDa\nGenBank Accession Number: BC132765\nGene Symbol: ADAM23\nGene ID (NCBI): 8745\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O75077\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869802287273,"sku":"32969-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32969-1-ap","provider":"Iright","version":"1.0","type":"link"}