{"product_id":"proteintech-33028-1-ap","title":"Proteintech, 33028-1-AP, PLEKHN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PLEKHN1 (33028-1-AP) by Proteintech is a Polyclonal antibody targeting PLEKHN1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n33028-1-AP targets PLEKHN1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HT-29 cells,  mouse brain tissue,  mouse cerebellum tissue,  rat brain tissue,  rat cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPLEKHN1 (Pleckstrin Homology Domain Containing N1) is a protein-coding gene located on chromosome 1. It plays a crucial role in various cellular processes, including apoptosis and mRNA stability regulation. PLEKHN1 has been identified as a pro-apoptotic protein that enhances Bax-Bak hetero-oligomerization via interaction with Bid in colon cancer cells. (PMID: 29531808)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38741 Product name: Recombinant human PLEKHN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 200-350 aa of BC101386 Sequence: SAPPQGSCGDELPWTLQRRLTRLRTASGHEPGGSAVCASRVKLQHLPAQEQWDRLLVLYPTSLAIFSEELDGLCFKGELPLRAVHINLEEKEKQIRSFLIEGPLINTIRVVCASYEDYGHWLLCLRAVTHREGAPPLPGAESFPGSQVMGS Predict reactive species\nFull Name: pleckstrin homology domain containing, family N member 1\nCalculated Molecular Weight: 663 aa, 72 kDa\nObserved Molecular Weight: 66-71 kDa\nGenBank Accession Number: BC101386\nGene Symbol: PLEKHN1\nGene ID (NCBI): 84069\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q494U1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887766032553,"sku":"33028-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-33028-1-ap","provider":"Iright","version":"1.0","type":"link"}