{"product_id":"proteintech-33118-1-ap","title":"Proteintech, 33118-1-AP, XAGE2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe XAGE2 (33118-1-AP) by Proteintech is a Polyclonal antibody targeting XAGE2 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n33118-1-AP targets XAGE2 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nXAGE2 (member 2 of the X antigen family), also known as CT12.2, GAGED3, XAGE-2, and XAGE2B, is a cancer-testis (CT) antigen that belongs to the GAGE family. This protein is strongly expressed in normal testes and is abnormally expressed in various tumors, including Ewing's sarcoma, rhabdomyosarcoma, breast cancer, and germ cell tumors. The XAGE2 protein shares sequence similarity with other GAGE\/PAGE proteins, and its expression pattern and sequence similarity make it a member of the CT antigen family.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35814 Product name: Recombinant human XAGE2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 17-111 aa of NM_130777 Sequence: LQPPELIGAMLEPTDEEPKEEKPPTKSRNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV Predict reactive species\nFull Name: X antigen family, member 2\nCalculated Molecular Weight: 12kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: NM_130777\nGene Symbol: XAGE2\nGene ID (NCBI): 9502\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q96GT9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887924629673,"sku":"33118-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-33118-1-ap","provider":"Iright","version":"1.0","type":"link"}