{"product_id":"proteintech-33132-1-ap","title":"Proteintech, 33132-1-AP, Phosducin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Phosducin (33132-1-AP) by Proteintech is a Polyclonal antibody targeting Phosducin in WB, IHC, ELISA applications with reactivity to human, mouse samples\n33132-1-AP targets Phosducin in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse retina tissue\nPositive IHC detected in: mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPhosducin\/PDC, which tightly binds betagamma-subunits of heterotrimeric G-proteins, has been conjectured to play a role in regulating second messenger signaling cascades. Phosducin may act as a phosphorylation-dependent switch in second messenger signaling cascades, regulating the kinetics of desensitization processes by controlling the activity of Gbetagamma-dependent GRKs (PMID: 9020189).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37137 Product name: Recombinant human PDC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-140 aa of NM_002597.4 Sequence: KFKLESQDSDSIPPSKKEILRQMSSPQSRNGKDSKERVSRKMSIQEYELIHKEKEDENCLRKYRRQCMQDMHQKLSFGPRYGFVYELETGKQFLETIEKELKITTIVVHI Predict reactive species\nFull Name: phosducin\nCalculated Molecular Weight: 28 kDa, 246 aa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: NM_002597.4\nGene Symbol: PDC\nGene ID (NCBI): 5132\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P20941\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887758823593,"sku":"33132-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-33132-1-ap","provider":"Iright","version":"1.0","type":"link"}