{"product_id":"proteintech-33139-1-ap","title":"Proteintech, 33139-1-AP, KIF18B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KIF18B (33139-1-AP) by Proteintech is a Polyclonal antibody targeting KIF18B in IF\/ICC, IP, ELISA applications with reactivity to human samples\n33139-1-AP targets KIF18B in IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: Jurkat cells\nPositive IF\/ICC detected in: U2OS cells, Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKIF18B is a key member of the kinesin-8 family, involved in regulating various physiological processes such as microtubule length, spindle assembly, and chromosome alignment. This article briefly introduces the structure and physiological functions of KIF18B, examines its role in malignant tumors, and the associated carcinogenic signaling pathways such as PI3K\/AKT, Wnt\/β-catenin, and mTOR pathways. Research indicates that the upregulation of KIF18B enhances tumor malignancy and resistance to radiotherapy and chemotherapy. KIF18B could become a new target for anticancer drugs, offering significant potential for the treatment of malignant tumors and reducing chemotherapy resistance (PMID: 39259333).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36663 Product name: Recombinant human KIF18B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC136590 Sequence: MAVEDSTLQVVVRVRPPTPRELDSQRRPVVQVVDERVLVFNPEEPDGGFPGLKWGGTHDGPKKKGKDLTFVFDRVFGEAATQQDVFQHTTHSVLDSFLQGYNCSVFAYGA Predict reactive species\nFull Name: kinesin family member 18B\nCalculated Molecular Weight: 852 aa, 93 kDa\/833 aa, 91 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC136590\nGene Symbol: KIF18B\nGene ID (NCBI): 146909\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q86Y91\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887696105641,"sku":"33139-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-33139-1-ap","provider":"Iright","version":"1.0","type":"link"}