{"product_id":"proteintech-33144-1-ap","title":"Proteintech, 33144-1-AP, ANXA8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ANXA8 (33144-1-AP) by Proteintech is a Polyclonal antibody targeting ANXA8 in WB, ELISA applications with reactivity to human, mouse, rat samples\n33144-1-AP targets ANXA8 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Calu-1 cells, HeLa cells,  mouse skin tissue,  rat skin tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:3000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAnnexin A8 (ANXA8) gene, a member of the annexin family, encodes an anticoagulant protein involved in blood coagulation cascade and acts as an indirect inhibitor of the thromboplastin-specific complex. ANXA8 promotes the proliferation of endometrial cells through the Akt signalling pathway (PMID: 30040162). The expression levels of multiple cellular factors, including EGFR, PI3K, Akt, mTOR, p70S6K and 4EBP1, in the epidermal growth factor receptor (EGFR) signaling pathway were also altered by ANXA8 knockdown or overexpression in A549 cells, which confirmed the activation of the EGFR\/Akt\/mTOR signaling pathway by ANXA8 (PMID: 34671007).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag39741 Product name: Recombinant human ANXA8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 70-188 aa of BC073755 Sequence: DLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEILASRTKNQLREIMKAYEEDYGSSLEEDIQADTSGYLERILVCLLQGSRDDVSSFVDPALALQDAQDLYA Predict reactive species\nFull Name: annexin A8\nCalculated Molecular Weight: 36 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC073755\nGene Symbol: ANXA8\nGene ID (NCBI): 653145\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P13928\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46884971118761,"sku":"33144-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-33144-1-ap","provider":"Iright","version":"1.0","type":"link"}