{"product_id":"proteintech-33156-1-ap","title":"Proteintech, 33156-1-AP, CXCL4\/PF4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CXCL4\/PF4 (33156-1-AP) by Proteintech is a Polyclonal antibody targeting CXCL4\/PF4 in WB, ELISA applications with reactivity to mouse, rat samples\n33156-1-AP targets CXCL4\/PF4 in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spleen tissue, rat spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe chemokine (C-X-C motif) ligand 4 (CXCL4) is also named as PF4 (Platelet factor-4) and SCYB4. The platelets, the most abundant source of CXCL4 in vivo, control profibrotic macrophage activation via CXCL4. (PMID: 36807143). Exogenous CXCL4 drove profibrotic activation of monocyte-derived dendritic cells in vitro (PMID: 33042127). Platelet factor-4 is a 70-amino acid protein that is released from the alpha-granules of activated platelets and binds with high affinity to heparin. Its major physiologic role appears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg3345 Product name: Recombinant Mouse CXCL4\/PF4 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 30-105 aa of NM_019932 Sequence: VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES Predict reactive species\nFull Name: platelet factor 4\nCalculated Molecular Weight: 11kd\nObserved Molecular Weight: 12 kDa, 14 kDa\nGenBank Accession Number: NM_019932\nGene Symbol: Pf4\nGene ID (NCBI): 56744\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9Z126\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886964428969,"sku":"33156-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-33156-1-ap","provider":"Iright","version":"1.0","type":"link"}