{"product_id":"proteintech-33205-1-ap","title":"Proteintech, 33205-1-AP, PRDM6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PRDM6 (33205-1-AP) by Proteintech is a Polyclonal antibody targeting PRDM6 in WB, ELISA applications with reactivity to human samples\n33205-1-AP targets PRDM6 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, MCF-7 cells,  MDA-MB-231 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPRDM6 is a poorly characterized member of the PRDF1 and RIZ1 homology domain-containing (PRDM) family of transcription factors that possess histone lysine methyltransferase activities through their catalytic SET domain. Based on findings in other species, PRDM6 is currently classified as a pseudo-methyltransferase that may interact with the methyltransferase G9a and corepressors to indirectly affect the methylation status of histone H3 lysine and histone H4 lysine. PRDM6 inhibition may have therapeutic value in PRDM6-expressing medulloblastomas (PMID: 38992221). PRDM6 has one glycosylation modification site.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38054 Product name: Recombinant human PRDM6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 380-595 aa of NM_001136239 Sequence: AQDENLNVPSTVMEAMCRQDALQPFNKSSKLAPTTQQRSVVFPQTPCSRNFSLLDKSGPIESGFNQINVKNQRVLASPTSTSQLHSEFSDWHLWKCGQCFKTFTQRILLQMHVCTQNPDRPYQCGHCSQSFSQPSELRNHVVTHSSDRPFKCGYCGRAFAGATTLNNHIRTHTGEKPFKCERCERSFTQATQLSRHQRMPNECKPITESPESIEVD Predict reactive species\nFull Name: PR domain containing 6\nCalculated Molecular Weight: 595aa, 64 kDa\nObserved Molecular Weight: 75 kDa\nGenBank Accession Number: NM_001136239\nGene Symbol: PRDM6\nGene ID (NCBI): 93166\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9NQX0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887772651689,"sku":"33205-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-33205-1-ap","provider":"Iright","version":"1.0","type":"link"}