{"product_id":"proteintech-33230-1-ap","title":"Proteintech, 33230-1-AP, Cathepsin D Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cathepsin D (33230-1-AP) by Proteintech is a Polyclonal antibody targeting Cathepsin D in WB, ELISA applications with reactivity to mouse samples\n33230-1-AP targets Cathepsin D in WB, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BV-2 cells, Neuro-2a cells,  J774A.1 cells,  RAW 264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCTSD (Cathepsin D) also named CPSD, is a representative aspartic proteinase in lysosomes and is widely distributed in various tissue cells of mammals.  The expression level of CTSD varies depending on the tissue, whereas neurons in CNS tissues possess abundant CTSD. CTSD is synthesized as a 52-kDa precursor that is converted into an active ~48-kDa single-chain intermediate in the endosomes, and then into a fully active mature form, composed of a 28-kDa heavy chain and a 14-kDa light chain, in the lysosomes (PMID: 10995834, PMID: 7641679, PMID: 30051532).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg2986 Product name: Recombinant Mouse Cathepsin D protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 21-410 aa of NM_009983.3 Sequence: IIRIPLRKFTSIRRTMTEVGGSVEDLILKGPITKYSMQSSPKTTEPVSELLKNYLDAQYYGDIGIGTPPQCFTVVFDTGSSNLWVPSIHCKILDIACWVHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDQSKARGIKVEKQIFGEATKQPGIVFVAAKFDGILGMGYPHISVNNVLPVFDNLMQQKLVDKNIFSFYLNRDPEGQPGGELMLGGTDSKYYHGELSYLNVTRKAYWQVHMDQLEVGNELTLCKGGCEAIVDTGTSLLVGPVEEVKELQKAIGAVPLIQGEYMIPCEKVSSLPTVYLKLGGKNYELHPDKYILKVSQGGKTICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNRVGFANAVVL Predict reactive species\nFull Name: cathepsin D\nCalculated Molecular Weight: 45 kDa\nObserved Molecular Weight: 14 kDa ,28 kDa, 46~52 kDa\nGenBank Accession Number: NM_009983.3\nGene Symbol: Ctsd\nGene ID (NCBI): 13033\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P18242\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885841469609,"sku":"33230-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-33230-1-ap","provider":"Iright","version":"1.0","type":"link"}