{"product_id":"proteintech-33235-1-ap","title":"Proteintech, 33235-1-AP, DcTRAILR1\/TNFRSF23 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DcTRAILR1\/TNFRSF23 (33235-1-AP) by Proteintech is a Polyclonal antibody targeting DcTRAILR1\/TNFRSF23 in WB, ELISA applications with reactivity to mouse, rat samples\n33235-1-AP targets DcTRAILR1\/TNFRSF23 in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spleen tissue, mouse thymus tissue,  rat spleen tissue,  rat thymus tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDecoy TRAIL receptor 1 (DcTRAILR1), also known as tumor necrosis factor receptor superfamily member 23 (TNFRSF23), is a GPI-anchored mouse TNF receptor superfamily member that lacks a cytoplasmic death domain. It is a decoy TRAIL receptor that can block TRAIL-induced apoptosis (PMID: 12466268). It has been reported that upregulation of DcTRAILR1 can prolong the lifespan of tumor-associated neutrophils (PMID: 39558859; 38207030).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg5262 Product name: recombinant mouse DcTRAILR1\/TNFRSF23 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 30-155 aa of NM_024290.4 Sequence: MPESYSFNCPDGEYQSNDVCCKTCPSGTFVKAPCKIPHTQGQCEKCHPGTFTGKDNGLHDCELCSTCDKDQNMVADCSATSDRKCECQIGLYYYDPKFPESCRPCTKCPQGIPVLQECNSTANTVC Predict reactive species\nFull Name: tumor necrosis factor receptor superfamily, member 23\nCalculated Molecular Weight: 20 kDa\nObserved Molecular Weight: 24 kDa\nGenBank Accession Number: NM_024290.4\nGene Symbol: Tnfrsf23\nGene ID (NCBI): 79201\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9ER63\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887093895337,"sku":"33235-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-33235-1-ap","provider":"Iright","version":"1.0","type":"link"}