{"product_id":"proteintech-33326-1-ap","title":"Proteintech, 33326-1-AP, Tesmin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Tesmin (33326-1-AP) by Proteintech is a Polyclonal antibody targeting Tesmin in WB, ELISA applications with reactivity to human samples\n33326-1-AP targets Tesmin in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTestis Expressed Metallothionein Like Protein (Tesmin), also known as Metallothionein-Like 5 (MTL5), encodes the metallothionein-like protein owning some characteristics of metallothionein. Tesmin is a 60 kDa protein which has cysteine-rich motifs (CXC domain), characteristic of metallothioneins (MTs). Tesmin was closely related to meiosis in the reproductive process. As a testis-specific protein, the localization of Tesmin changed dynamically with the progression of meiosis in a mouse experiment, the process of which might be responsive to metal stress like cadmium by oxidative stress (Cd), as well as require the involvement of LIN9. So far, the expression of Tesmin in adult humans has been observed in prostate and gastric cancer (PMID: 39229988, PMID: 33281959, PMID: 31059101).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag39255 Product name: Recombinant human MTL5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 158-306 aa of NM_004923.3 Sequence: VEIKEAGGTTTSNNPEEATLQNLLAQESCCKFPSSQELEDASCCSLKKDSNPMVICQLKGGTQMLCIDNSRTRELKALHLVPQYQDQNNYLQSDVPKPMTALVGRFLPASTKLNLITQQLEGALPSVVNGSAFPSGSTLPGPPKITLAG Predict reactive species\nFull Name: metallothionein-like 5, testis-specific (tesmin)\nCalculated Molecular Weight: 55kDa，508aa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: NM_004923.3\nGene Symbol: MTL5\nGene ID (NCBI): 9633\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9Y4I5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887825866921,"sku":"33326-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-33326-1-ap","provider":"Iright","version":"1.0","type":"link"}