{"product_id":"proteintech-33334-1-ap","title":"Proteintech, 33334-1-AP, ARMS2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARMS2 (33334-1-AP) by Proteintech is a Polyclonal antibody targeting ARMS2 in IHC, ELISA applications with reactivity to human, mouse samples\n33334-1-AP targets ARMS2 in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAge-related maculopathy susceptibility 2 (ARMS2) is a small (11 kDa), primate-specific protein found in the extracellular matrix of the choroid layer in the eye. Variants in the corresponding genetic locus are highly associated with age-related macular degeneration, a leading cause of blindness in the elderly (PMID: 27270414).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37837 Product name: Recombinant human ARMS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-107 aa of NM_001099667 Sequence: MLRLYPGPMVTEAEGKGGPEMASLSSSVVPVSFISTLRESVLDPGVGGEGASDKQRSKLSLSHSMIPAAKIHTELCLPAFFSPAGTQRRFQQPQHHLTLSIIHTAAR Predict reactive species\nFull Name: age-related maculopathy susceptibility 2\nCalculated Molecular Weight: 107aa, 11 kDa\nGenBank Accession Number: NM_001099667\nGene Symbol: ARMS2\nGene ID (NCBI): 387715\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P0C7Q2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885061820585,"sku":"33334-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-33334-1-ap","provider":"Iright","version":"1.0","type":"link"}