{"product_id":"proteintech-33363-1-ap","title":"Proteintech, 33363-1-AP, Luteinizing Hormone beta Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Luteinizing Hormone beta (33363-1-AP) by Proteintech is a Polyclonal antibody targeting Luteinizing Hormone beta in WB, ELISA applications with reactivity to human samples\n33363-1-AP targets Luteinizing Hormone beta in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: fetal human brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLuteinizing Hormone beta subunit (LH-β) is a critical glycoprotein hormone chain that confers functional specificity to the intact LH hormone. While it non-covalently associates with the common alpha subunit (shared with other pituitary hormones like FSH and TSH), the unique beta subunit is responsible for dictating receptor binding specificity. The binding of LH to its receptor in the gonads is primarily mediated by the beta subunit, triggering signaling cascades essential for reproductive physiology. In females, this stimulates ovulation and progesterone production, and in males, it drives testosterone synthesis in Leydig cells. Therefore, the expression and structural integrity of the LH-β gene are indispensable for the regulation of steroidogenesis and gametogenesis, making it a cornerstone of the hypothalamic-pituitary-gonadal axis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38132 Product name: Recombinant human Luteinizing Hormone beta protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-141 aa of NM_000894 Sequence: SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL* Predict reactive species\nFull Name: luteinizing hormone beta polypeptide\nCalculated Molecular Weight: 15 kDa\nObserved Molecular Weight: 15-18 kDa\nGenBank Accession Number: NM_000894\nGene Symbol: LHB\nGene ID (NCBI): 3972\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P01229\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887709704361,"sku":"33363-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-33363-1-ap","provider":"Iright","version":"1.0","type":"link"}