{"product_id":"proteintech-33396-1-ap","title":"Proteintech, 33396-1-AP, SLAMF6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLAMF6 (33396-1-AP) by Proteintech is a Polyclonal antibody targeting SLAMF6 in WB, IHC, ELISA applications with reactivity to mouse samples\n33396-1-AP targets SLAMF6 in WB, IHC, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spleen tissue, mouse thymus tissue\nPositive IHC detected in: mouse spleen tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:4000-1:16000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSignaling lymphocyte activation molecule 6 (SLAMF6) (Ly108 in mice, NTB-A or SF2000 in humans) is a homophilic receptor belonging to the superfamily immunoglobulin (Ig) domain-containing molecules (PMID:31199820). SLAMF6 is a type I transmembrane protein with two extracellular immunoglobins (Ig)-like domains and three cytoplasmic tyrosine-based signaling motifs, one of which is immunoreceptor tyrosine-based switch motif (PMID:31315913). SLAMF6 is expressed on a wide variety of immune cells including T cells (also TFH), B cells, NK cells (expressed in humans only), double positive thymocytes, eosinophils, and neutrophils (mouse only) (PMID:11862385).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg5249 Product name: recombinant mouse SLAMF6\/CD352 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 31-239 aa of NM_030710.2 Sequence: EVSQSSSDPQLMNGVLGESAVLPLKLPAGKIANIIIWNYEWEASQVTALVINLSNPESPQIMNTDVKKRLNITQSYSLQISNLTMADTGSYTAQITTKDSEVITFKYILRVFERLGNLETTNYTLLLENGTCQIHLACVLKNQSQTVSVEWQATGNISLGGPNVTIFWDPRNSGDQTYVCRAKNAVSNLSVSVSTQSLCKGVLTNPPWN Predict reactive species\nFull Name: SLAM family member 6\nCalculated Molecular Weight: 36 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: NM_030710.2\nGene Symbol: Slamf6\nGene ID (NCBI): 30925\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9ET39-2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887802962089,"sku":"33396-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-33396-1-ap","provider":"Iright","version":"1.0","type":"link"}