{"product_id":"proteintech-33428-1-ap","title":"Proteintech, 33428-1-AP, REG Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe REG (33428-1-AP) by Proteintech is a Polyclonal antibody targeting REG in WB, ELISA applications with reactivity to mouse, rat samples\n33428-1-AP targets REG in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse pancreas tissue, rat pancreas tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV, based on the primary structures of the encoded proteins. This gene encodes a protein that is secreted by the exocrine pancreas. It is associated with islet cell regeneration and diabetogenesis and may be involved in pancreatic lithogenesis. It's reported that REG1A was significantly upregulated in tumor specimens and adenoma as compared to normal colorectal tissue. (PMID: 34698109)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg6797 Product name: Recombinant mouse Reg1 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-165 aa of NM_009042.1 Sequence: QEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYLVSVLSQAEGNFVASLIKESGTTDANVWTGLHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVCKFKG Predict reactive species\nFull Name: regenerating islet-derived 1\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: NM_009042.1\nGene Symbol: Reg1\nGene ID (NCBI): 19692\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P43137\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887782023337,"sku":"33428-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-33428-1-ap","provider":"Iright","version":"1.0","type":"link"}