{"product_id":"proteintech-33470-1-ap","title":"Proteintech, 33470-1-AP, GRK4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GRK4 (33470-1-AP) by Proteintech is a Polyclonal antibody targeting GRK4 in WB, ELISA applications with reactivity to human, mouse samples\n33470-1-AP targets GRK4 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: RAW 264.7 cells, mouse brain tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nG protein-coupled receptor kinase 4 (GRK4) is a serine and threonine kinase that phosphorylates G protein-coupled receptors in response to agonist stimulation. It uncouples the dopamine receptor from its G protein. It should also be noted that kinase activity is not necessary for some GRK-mediated functions.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38007 Product name: Recombinant human GRK4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 381-510 aa of NM_182982.2 Sequence: QGHSPFKKYKEKVKWEEVDQRIKNDTEEYSEKFSEDAKSICRMLLTKNPSKRLGCRGEGAAGVKQHPVFKDINFRRLEANMLEPPFCPDPHAVYCKDVLDIEQFSVVKGIYLDTADEDFYARFATGCVSI Predict reactive species\nFull Name: G protein-coupled receptor kinase 4\nCalculated Molecular Weight: NM_182982.2\nObserved Molecular Weight: 67 kDa\nGenBank Accession Number: NM_182982.2\nGene Symbol: GRK4\nGene ID (NCBI): 2868\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P32298\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887659929769,"sku":"33470-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-33470-1-ap","provider":"Iright","version":"1.0","type":"link"}