{"product_id":"proteintech-33511-1-ap","title":"Proteintech, 33511-1-AP, TMEM256 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM256 (33511-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM256 in WB, ELISA applications with reactivity to human samples\n33511-1-AP targets TMEM256 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, Calu-1 cells,  LNCaP cells,  U-251 cells,  Y79 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM256, also known as C17orf61, is a number of TMEM families, encodes a protein of ~11.7 kDa, TMEM256 is expressed in proximal renal tubular cells, and its subcellular localization is in exosomes (PMID: 39991002).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36789 Product name: Recombinant human C17orf61 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-92 aa of BC030270 Sequence: AQFPDAYGKELFDKANKHHFLHSLALLGVPHCRKPLWAGLLLASGTTLFCTSFYYQALSGDPS Predict reactive species\nFull Name: chromosome 17 open reading frame 61\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC030270\nGene Symbol: C17orf61\nGene ID (NCBI): 254863\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8N2U0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887832092841,"sku":"33511-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-33511-1-ap","provider":"Iright","version":"1.0","type":"link"}