{"product_id":"proteintech-33583-1-ap","title":"Proteintech, 33583-1-AP, TBC1D8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TBC1D8 (33583-1-AP) by Proteintech is a Polyclonal antibody targeting TBC1D8 in WB, IHC, ELISA applications with reactivity to human samples\n33583-1-AP targets TBC1D8 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, Calu-1 cells\nPositive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe TBC1D8 protein is a member of the TBC domain family and functions as a GTPase-activating protein (GAP) that negatively regulates the activity of small G proteins of the Rab family, participating in the fine-tuning of intracellular vesicle transport and signal transduction. This protein has garnered significant attention in reproductive and cancer research. Studies have shown that TBC1D8 is a key determinant of oocyte maturation and female fertility, with defects in its expression leading to embryonic development arrest. Moreover, TBC1D8 is abnormally overexpressed in various cancers (such as breast and lung cancer), where it acts as an oncogene by modulating signaling pathways related to cell proliferation, invasion, and metastasis (e.g., the EGFR\/Ras pathway). Thus, it serves as a potential biomarker for disease diagnosis and a therapeutic target.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35398 Product name: Recombinant human TBC1D8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 941-1140 aa of NM_001102426 Sequence: RNPLLSTSRPLVFGKPNGDAVDYQKQLKQMIKDLAKEKDKTEKELPKMSQREFIQFCKTLYSMFHEDPEENDLYQAIATVTTLLLQIGEVGQRGSSSGSCSQECGEELRASAPSPEDSVFADTGKTPQDSQAFPEAAERDWTVSLEHILASLLTEQSLVNFFEKPLDMKSKLENAKINQYNLKTFEMSHQSQSELKLSNL Predict reactive species\nFull Name: TBC1 domain family, member 8 (with GRAM domain)\nCalculated Molecular Weight: 130kDa\nObserved Molecular Weight: 130 kDa\nGenBank Accession Number: NM_001102426\nGene Symbol: TBC1D8\nGene ID (NCBI): 11138\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O95759\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887823671465,"sku":"33583-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-33583-1-ap","provider":"Iright","version":"1.0","type":"link"}