{"product_id":"proteintech-33600-1-ap","title":"Proteintech, 33600-1-AP, CCDC63 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCDC63 (33600-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC63 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n33600-1-AP targets CCDC63 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\nPositive IP detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCDC63 (Coiled-Coil Domain Containing 63) is a highly conserved centrosomal satellite protein whose main functions are closely related to cell mitosis and ciliogenesis. This protein directly interacts with PCM1, a key organizer of centrosomal satellites, through its coiled-coil domain and is recruited to the pericentriolar material. As an important component of centrosomal satellites, CCDC63 is involved in regulating the normal assembly of the centrosome, microtubule anchoring, and proper orientation of the spindle, thereby ensuring the fidelity of chromosome segregation and genomic stability. Therefore, CCDC63 is one of the core molecules that maintain the accuracy of cell division and the function of organelles.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag39252 Product name: Recombinant human CCDC63 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of NM_152591.2 Sequence: MSVLKKNRRKDSDTPQEPSEKAKEQQAEAELRKLRQQFRKMVESRKSFKFRNQQKIASQYKEIKTLKTEQDEITLLLSLMKSSRNMNRSEKNYMELRLLLQTKEDYEALIKSLKVLLAELDEKILQMEKKIANQKQIFAKMQEANNPRKLQKQIHILETRLNLVTVHFDKMLTTNAKLRKEIEDLRFEKAAYDNVYQQLQ Predict reactive species\nFull Name: coiled-coil domain containing 63\nCalculated Molecular Weight: 66kDa，563aa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: NM_152591.2\nGene Symbol: CCDC63\nGene ID (NCBI): 160762\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8NA47\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885974704297,"sku":"33600-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-33600-1-ap","provider":"Iright","version":"1.0","type":"link"}