{"product_id":"proteintech-33639-1-ap","title":"Proteintech, 33639-1-AP, GGA3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GGA3 (33639-1-AP) by Proteintech is a Polyclonal antibody targeting GGA3 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n33639-1-AP targets GGA3 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, Calu-1 cells,  SH-SY5Y cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGolgi-associated, gamma-adaptin ear-containing, ARF-binding protein 3 (GGA3) is a monomeric clathrin adaptor that localizes predominantly to the trans-Golgi network (TGN) and endosomal membranes. Beyond classical cargo sorting, GGA3 participates in receptor recycling, retrograde transport and signal termination. Notably, caspase-3 cleaves GGA3 during apoptosis or cerebral ischaemia; loss of this adaptor stabilises β-secretase (BACE1), thereby increasing amyloid-β production and linking GGA3 to Alzheimer disease pathogenesis. Recent work further implicates GGA3 in oncogenic processes: in non-small-cell lung cancer it supports TrkA trafficking to the plasma membrane, prolonging Akt\/ERK signalling and promoting cell survival.(PMID: 39267722, PMID: 37586201)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38658 Product name: Recombinant human GGA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 363-550 aa of NM_138619.3 Sequence: SGPPRSRSSSQAEATLGPSSTSNALSWLDEELLCLGLADPAPNVPPKESAGNSQWHLLQREQSDLDFFSPRPGTAACGASDAPLLQPSAPSSSSSQAPLPPPFPAPVVPASVPAPSAGSSLFSTGVAPALAPKVEPAVPGHHGLALGNSALHHLDALDQLLEEAKVTSGLVKPTTSPLIPTTTPARPL Predict reactive species\nFull Name: golgi associated, gamma adaptin ear containing, ARF binding protein 3\nCalculated Molecular Weight: 78kDa，723aa\nObserved Molecular Weight: 90 kDa\nGenBank Accession Number: NM_138619.3\nGene Symbol: GGA3\nGene ID (NCBI): 23163\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9NZ52\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887650197673,"sku":"33639-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-33639-1-ap","provider":"Iright","version":"1.0","type":"link"}