{"product_id":"proteintech-33696-1-ap","title":"Proteintech, 33696-1-AP, HSPA12A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HSPA12A (33696-1-AP) by Proteintech is a Polyclonal antibody targeting HSPA12A in WB, ELISA applications with reactivity to human, mouse, rat samples\n33696-1-AP targets HSPA12A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: fetal human brain tissue, mouse brain tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHeat shock protein A12A (HSPA12A) is a distant member of the HSP70 family, which is widely expressed with highest levels in brain, kidney and muscle (PMID: 12552099). HSPA12A encodes a prosurvival pathway against endotoxemic liver injury. Particularly, glycolytic activity in cancer cells is regulated by HSPA12A. HSPA12A modulates glycolysis-derived lactate to affect HMGB1 lactylation and secretion from hepatocytes, by which changes macrophage chemotaxis and activation, and finally affects LI\/R injury (PMID: 37441587).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36620 Product name: Recombinant human HSPA12A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 516-675 aa of BC156889 Sequence: PPEKLLVKDGTRWCTDVFDKFISADQSVALGELVKRSYTPAKPSQLVIVINIYSSEHDNVSFITDPGVKKCGTLRLDLTGTSGTAVPARREIQTLMQFGDTEIKATAIDIATSKSVKVGIDFLNY Predict reactive species\nFull Name: heat shock 70kDa protein 12A\nCalculated Molecular Weight: 675 aa, 75 kDa\nObserved Molecular Weight: 75 kDa\nGenBank Accession Number: BC156889\nGene Symbol: HSPA12A\nGene ID (NCBI): 259217\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O43301\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887672381609,"sku":"33696-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-33696-1-ap","provider":"Iright","version":"1.0","type":"link"}