{"product_id":"proteintech-33698-1-ap","title":"Proteintech, 33698-1-AP, TAT Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TAT (33698-1-AP) by Proteintech is a Polyclonal antibody targeting TAT in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n33698-1-AP targets TAT in IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse liver tissue, rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTyrosine aminotransferase, also known as tyrosine transaminase, is the first enzyme in the catabolic pathway of tyrosine. The gene of this transaminase is regulated by glucocorticoid hormones as well as via the cAMP pathway. TAT reversibly catalyses Tyr to 4-hydroxyphenylpyruvate (4-HPP), which is the substrate for pathways producing plastoquinone31, 32, tocopherols33, phenolic acid14, 28, and benzylisoquinoline alkaloid (BIA)34 in plants, although tyrosine is synthesised from 4-HPP by TAT in bacteria (28687763).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag39227 Product name: Recombinant human TAT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 294-454 aa of BC130534 Sequence: IHDRRDIFGNEIRDGLVKLSQRILGPCTIVQGALKSILCRTPGEFYHNTLSFLKSNADLCYGALAAIPGLRPVRPSGAMYLMVGIEMEHFPEFENDVEFTERLVAEQSVHCLPATCFEYPNFIRVVITVPEVMMLEACSRIQEFCEQHYHCAEGSQEECDK Predict reactive species\nFull Name: tyrosine aminotransferase\nGenBank Accession Number: BC130534\nGene Symbol: TAT\nGene ID (NCBI): 6898\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P17735\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887823081641,"sku":"33698-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-33698-1-ap","provider":"Iright","version":"1.0","type":"link"}