{"product_id":"proteintech-33842-1-ap","title":"Proteintech, 33842-1-AP, NTNG2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NTNG2 (33842-1-AP) by Proteintech is a Polyclonal antibody targeting NTNG2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n33842-1-AP targets NTNG2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse retina tissue, rat retina tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNTNG2, also known as Netrin-G2, belongs to the Netrin family and operates through binding with its receptors. It is involved in controlling patterning and neuronal circuit formation at the laminar, cellular, subcellular and synaptic levels. It also promotes neurite outgrowth of both axons and dendrites (PMID: 21946559). NTNG2 has two isoforms with molecular weights of 59 kDa and 47 kDa respectively. According to the Uniprot website, this protein contains a signal peptide and a propeptide, so the molecular weight of the mature protein is approximately 50 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38229 Product name: Recombinant human NTNG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 230-504 aa of BC013770 Sequence: MDNLYTRLESAKGLKEFFTLTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCSMREGSLQCECEHNTTGPDCGKCKKNFRTRSWRAGSYLPLPHGSPNACAAAGSFGNCECYGHSNRCSYIDFLNVVTCVSCKHNTRGQHCQHCRLGYYRNGSAELDDENVCIECNCNQIGSVHDRCNETGFCECREGAAGPKCDDCLPTHYWRQGCYPNVCDDDQLLCQNGGTCLQNQRCACPRGYTGVRCEQPRCDPADDDGGLDCDR Predict reactive species\nFull Name: netrin G2\nCalculated Molecular Weight: 60 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC013770\nGene Symbol: NTNG2\nGene ID (NCBI): 84628\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q96CW9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887743717545,"sku":"33842-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-33842-1-ap","provider":"Iright","version":"1.0","type":"link"}