{"product_id":"proteintech-33911-1-ap","title":"Proteintech, 33911-1-AP, DQX1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DQX1 (33911-1-AP) by Proteintech is a Polyclonal antibody targeting DQX1 in WB, ELISA applications with reactivity to human samples\n33911-1-AP targets DQX1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HepG2 cells,  L02 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDQX1, also known as DEAQ-box RNA helicase 1, is a member of the Asp-Glu-Ala-Asp (DEAD)-box family of RNA helicases, specifically falling into the DEAQ subfamily based on its unique variant motif sequence. These proteins are characterized by conserved motifs involved in ATP binding, hydrolysis, and RNA unwinding\/remodeling, playing crucial roles in virtually all aspects of RNA metabolism.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag40792 Product name: Recombinant human DQX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 62-161 aa of BC075018 Sequence: DSLQGLLQDARLEKLPGDLRVVVVTDPALEPKLRAFWGNPPIVHIPREPGERPSPIYWDTIPPDRVEAACQAVLELCRKELPGDVLVFLPSEEEISLCCE Predict reactive species\nFull Name: DEAQ box RNA-dependent ATPase 1\nCalculated Molecular Weight: 599 aa, 67 kDa\nObserved Molecular Weight: 79 kDa\nGenBank Accession Number: BC075018\nGene Symbol: DQX1\nGene ID (NCBI): 165545\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8TE96\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887316816041,"sku":"33911-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-33911-1-ap","provider":"Iright","version":"1.0","type":"link"}