{"product_id":"proteintech-33935-1-ap","title":"Proteintech, 33935-1-AP, DBX1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DBX1 (33935-1-AP) by Proteintech is a Polyclonal antibody targeting DBX1 in WB, ELISA applications with reactivity to human samples\n33935-1-AP targets DBX1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A2780 cells, SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDBX1 (Homeobox protein DBX1) is a central nervous system (CNS)-specific transcription factor that plays crucial roles in embryonic brain development. It belongs to the H2.0 homeobox family and contains a DNA-binding homeodomain, which allows it to regulate gene expression by binding to specific DNA sequences.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag40954 Product name: Recombinant human DBX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 241-343 aa of NM_001029865 Sequence: ERELLSSGGCREQTLPTKLNPHPDLSDVGQKGPGNEEEEEGPGSPSHRLAYHASSDPQHLRDPRLPGPLPPSPAHSSSPGKPSDFSDSEEEEEGEEQEEITVS Predict reactive species\nFull Name: developing brain homeobox 1\nCalculated Molecular Weight: 343aa, 37 kDa\nObserved Molecular Weight: 40-45 kDa\nGenBank Accession Number: NM_001029865\nGene Symbol: DBX1\nGene ID (NCBI): 120237\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: A6NMT0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887064141993,"sku":"33935-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-33935-1-ap","provider":"Iright","version":"1.0","type":"link"}