{"product_id":"proteintech-33961-1-ap","title":"Proteintech, 33961-1-AP, MVB12B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe  MVB12B (33961-1-AP) by Proteintech is a Polyclonal antibody targeting  MVB12B in WB, ELISA applications with reactivity to human samples\n33961-1-AP targets  MVB12B in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM125B\/MVB12B gene codes for a component of a membrane complex involved in vesicular trafficking process, a function similar to that of the Caveolin genes (CAV1 and CAV2) which have previously been associated with primary open-angle glaucoma (PMID: 24518671). MVB12b is also a target for TANK-binding kinase 1 phosphorylation, which is essential for the sorting of DNA into EVs and stimulation of bystander cells (PMID: 30804548).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag40577 Product name: Recombinant human FAM125B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-200 aa of BC000122 Sequence: TMPEVKDLSEALPETSMDPITGVGVVASRNRAPTGYDVVAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENSHLGNVLVDMKLIDIKDTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRIMGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDS Predict reactive species\nFull Name: family with sequence similarity 125, member B\nCalculated Molecular Weight: 319 aa, 36 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC000122\nGene Symbol: FAM125B\nGene ID (NCBI): 89853\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9H7P6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887729823913,"sku":"33961-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-33961-1-ap","provider":"Iright","version":"1.0","type":"link"}