{"product_id":"proteintech-33977-1-ap","title":"Proteintech, 33977-1-AP, ZNF7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZNF7 (33977-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF7 in IP, ELISA applications with reactivity to human samples\n33977-1-AP targets ZNF7 in IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: HL-60 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZinc Finger Protein 7 (ZNF7) is a key member of the human zinc finger protein (KRAB-ZFP) family. This protein contains a typical KRAB domain and tandem C2H2-type zinc finger motifs, enabling it to specifically bind to DNA sequences in the promoter regions of target genes. As a nuclear transcription regulator, ZNF7 recruits epigenetic modification complexes, such as histone deacetylases, to suppress downstream gene expression, thereby playing a role in maintaining genomic stability and chromatin remodeling. Research indicates that ZNF7 plays a crucial role in cell cycle regulation, DNA damage response, and embryonic development. Abnormal expression of ZNF7 is associated with the progression of various cancers, such as hepatocellular carcinoma and prostate cancer, and it may contribute to tumorigenesis by influencing oncogene or tumor suppressor gene networks. It is considered a promising target for epigenetic regulation research.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag40665 Product name: Recombinant human ZNF7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC058923 Sequence: MEVVTFGDVAVHFSREEWQCLDPGQRALYREVMLENHSSVAGLAGFLVFKPELISRLEQGEEPWVLDLQGAEGTEAPRTSKTDSTIRTENEQACEDMDILKSESYGTVVRISPQDFPQNPGFGDVSDSEVWLDSHLGSPGLKVTGFTFQN Predict reactive species\nFull Name: zinc finger protein 7\nCalculated Molecular Weight: 686 aa, 78 kDa\nObserved Molecular Weight: 68 kDa\nGenBank Accession Number: BC058923\nGene Symbol: ZNF7\nGene ID (NCBI): 7553\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P17097\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887952777385,"sku":"33977-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-33977-1-ap","provider":"Iright","version":"1.0","type":"link"}