{"product_id":"proteintech-33982-1-ap","title":"Proteintech, 33982-1-AP, FAM119B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM119B (33982-1-AP) by Proteintech is a Polyclonal antibody targeting FAM119B in WB, ELISA applications with reactivity to human, mouse, rat samples\n33982-1-AP targets FAM119B in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse pancreas tissue, rat pancreas tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEEF1AKMT3 (also known as METTL21B or FAM119B) is a gene that encodes a member of the methyltransferase-like (METTL) protein family. This enzyme functions as a specific lysine methyltransferase, with its primary and well-characterized substrate being eukaryotic translation elongation factor 1 alpha (eEF1A).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag40880 Product name: Recombinant human FAM119B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC099841 Sequence: MADPGPDPESESESVFPREVGLFADSYSEKSQFCFCGHVLTITQNFGSRLGVAARVWDAALSLCNYFESQ Predict reactive species\nFull Name: family with sequence similarity 119, member B\nCalculated Molecular Weight: 226 aa, 25 kDa\nObserved Molecular Weight: 25-30 kDa\nGenBank Accession Number: BC099841\nGene Symbol: FAM119B\nGene ID (NCBI): 25895\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q96AZ1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887630766249,"sku":"33982-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-33982-1-ap","provider":"Iright","version":"1.0","type":"link"}