{"product_id":"proteintech-33992-1-ap","title":"Proteintech, 33992-1-AP, TSKS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TSKS (33992-1-AP) by Proteintech is a Polyclonal antibody targeting TSKS in WB, ELISA applications with reactivity to human, mouse, rat samples\n33992-1-AP targets TSKS in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTestis-specific serine kinase substrate (TSKS) was identified as a substrate for testis-specific serine kinase 1 (TSSK1) and TSSK2. Although these three proteins co-localize to nuage, double knockout (KO) mice lacking TSSK1 and TSSK2 (Tssk1\/2 dKO mice) exhibit abnormal mitochondrial sheath formation, suggesting that these proteins and nuage are involved in mitochondrial sheath formation. However, the previous study observed abundant cytoplasm in the late spermatids at seminiferous tubule stage VIII of the Tssk1\/2 dKO mouse. Furthermore, an interaction between TSKS and phosphatase protein PPP1CC2 was also reported previously. Protein phosphatase 1 catalytic subunit gamma (Ppp1cc) is a member of the PP1 family of protein phosphatases that encodes two splice isoforms: the ubiquitous Ppp1cc1 and the testis-specific Ppp1cc2. Ppp1cc knockout (KO) male mice also exhibit malformed mitochondrial sheath formation. These data indicate that the kinase and phosphatase of TSKS are involved in the formation of the mitochondrial sheath (PMID: 36881620).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38588 Product name: Recombinant human TSKS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 328-592 aa of NM_021733.1 Sequence: EELRREVSSLTARWHQEEGAVQEALRLLGGLGGRVDGFLGQWERAQREQAQTARDLQELRGRADELCTMVERSAVSVASLRSELEGLGPLKPILEEFGRQFQNSRRGPDLSMNLDRSHQGNCARCASQGSQLSTESLQQLLDRALTSLVDEVKQRGLTPACPSCQRLHKKILELERQALAKHVRAEALSSTLRLAQDEALRAKNLLLTDKMKPEEKMATLDHLHLKMCSLHDHLSNLPLEGSTGTMGGGSSAGTPPKQGGSAPEQ Predict reactive species\nFull Name: testis-specific serine kinase substrate\nCalculated Molecular Weight: 65kDa，592aa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: NM_021733.1\nGene Symbol: TSKS\nGene ID (NCBI): 60385\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9UJT2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887840907433,"sku":"33992-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-33992-1-ap","provider":"Iright","version":"1.0","type":"link"}