{"product_id":"proteintech-34143-1-ap","title":"Proteintech, 34143-1-AP, CD160 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD160 (34143-1-AP) by Proteintech is a Polyclonal antibody targeting CD160 in WB, ELISA applications with reactivity to mouse, rat samples\n34143-1-AP targets CD160 in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat spleen tissue, mouse spleen tissue,  rat thymus tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD160 is a 27 kDa glycosylphosphatidylinositol (GPI)-anchored glycoprotein expressed on natural killer (NK) cells, T cell subsets (like cytotoxic T lymphocytes), and innate lymphoid cells. It functions as an activating or co-stimulatory receptor, depending on its ligand engagement. Its primary ligands are herpesvirus entry mediator (HVEM) and major histocompatibility complex class I chain-related molecules (MICs). The CD160-HVEM interaction plays a critical dual role: it can deliver co-stimulatory signals to enhance NK\/T cell cytotoxicity and cytokine production, but it can also inhibit T cell responses by engaging HVEM-associated signaling pathways. Thus, CD160 is a key regulator in immune cell activation, tumor surveillance, and autoimmune pathology (PMID: 21324341, PMID: 24882258, PMID: 36420268, PMID: 38360636).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg2585 Product name: recombinant mouse CD160 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 28-160 aa of NM_001163496.1 Sequence: GCIHVTSSASQKGGRLDLTCTLWHKKDEAEGLILFWCKDNPWNCSPETNLEQLRVKRDPETDGITEKSSQLVFTIEQATPSDSGTYQCCARSQKPEIYIHGHFLSVLVTGNHTEIRQRQRSHPDFSHINGTLS Predict reactive species\nFull Name: CD160 antigen\nCalculated Molecular Weight: 21kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: NM_001163496.1\nGene Symbol: Cd160\nGene ID (NCBI): 54215\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O88875\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886105612457,"sku":"34143-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-34143-1-ap","provider":"Iright","version":"1.0","type":"link"}