{"product_id":"proteintech-34174-1-ap","title":"Proteintech, 34174-1-AP, ZC3H7A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZC3H7A (34174-1-AP) by Proteintech is a Polyclonal antibody targeting ZC3H7A in WB, ELISA applications with reactivity to human samples\n34174-1-AP targets ZC3H7A in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  L02 cells,  MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZC3H7A (Zinc finger CCCH-type containing 7A, also known as HSPC055 or FLJ20318) is an RNA-binding protein containing zinc finger domains. This protein contains one C2H2-type zinc finger, three CCCH-type zinc fingers, and three TPR repeat sequences, belonging to the class III CCCH zinc finger protein family. ZC3H7A primarily functions in miRNA binding, where it recognizes miRNA hairpin sequences and participates in regulating miRNA biogenesis and processing. Research indicates that this protein plays a significant role in immune regulation: its expression is significantly upregulated upon macrophage activation, Th2 cell activation, and LPS stimulation, and it is enriched in immune organs such as the thymus and spleen. Notably, HIV vaccine studies have found that high expression of ZC3H7A is associated with decreased vaccine protective efficacy. Furthermore, genome-wide association studies suggest its correlation with QT interval duration, though the specific molecular mechanisms require further investigation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag40239 Product name: Recombinant human ZC3H7A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-205 aa of NM_014153.3 Sequence: MSNVSEERRKRQQNIKEGLQFIQSPLSYPGTQEQYAVYLRALVRNLFNEGNDVYREHDWNNSISQYTEALNIADYAKSEEILIPKEIIEKLYINRIACYSNMGFHDKVLEDCNIVLSLNASNCKALYRKSKALSDLGRYKKAYDAVAKCSLAVPQDEHVIKLTQELAQKLGFKIRKAYVRAELSLKSVPGDGATKALNHSVEDIE Predict reactive species\nFull Name: zinc finger CCCH-type containing 7A\nCalculated Molecular Weight: 110kDa，971aa\nObserved Molecular Weight: 110 kDa\nGenBank Accession Number: NM_014153.3\nGene Symbol: ZC3H7A\nGene ID (NCBI): 29066\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8IWR0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887927382185,"sku":"34174-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-34174-1-ap","provider":"Iright","version":"1.0","type":"link"}