{"product_id":"proteintech-51006-2-ap","title":"Proteintech, 51006-2-AP, PTRH2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PTRH2 (51006-2-AP) by Proteintech is a Polyclonal antibody targeting PTRH2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n51006-2-AP targets PTRH2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HEK-293 cells,  Jurkat cells,  MCF-7 cells,  Raji cells\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPTRH2 (Peptidyl-tRNA Hydrolase 2, also known as Bcl-2 Inhibitor of Transcription 1 or BIT1) is a highly conserved protein that plays crucial roles in various cellular processes, including protein synthesis, cell survival, and cell death.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0839 Product name: Recombinant human PTRH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC006807 Sequence: MPSKSLVMEYLAHPSTLGLAVGVACGMCLGWSLRVCFGMLPKSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY Predict reactive species\nFull Name: peptidyl-tRNA hydrolase 2\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 19 kDa\nGenBank Accession Number: BC006807\nGene Symbol: PTRH2\nGene ID (NCBI): 51651\nRRID: AB_2173280\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y3E5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887777534121,"sku":"51006-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-51006-2-ap","provider":"Iright","version":"1.0","type":"link"}