{"product_id":"proteintech-51042-1-ap","title":"Proteintech, 51042-1-AP, DDX4\/VASA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DDX4\/VASA (51042-1-AP) by Proteintech is a Polyclonal antibody targeting DDX4\/VASA in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n51042-1-AP targets DDX4\/VASA in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: mouse testis tissue, mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDEAD box proteins are characterized by nine conserved sequence motifs located on two functional domains. Domain I contains six of these motifs, including the Q motif and the Walker A motif, motifs Ia and Ib, the Walker B motif, and motif III, which may act to link ATPase and helicase activities of the protein [PMID:21653890]. DDX4, a member of the DEAD box family of ATP-dependent RNA helicases, plays a central role in several aspects of germ cell development. Its function is not only required during gametogenesis in the adult but is also essential for the specification of the germ cell lineage during embryogenesis [PMID:20016130].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0447 Product name: Recombinant human DDX4,VASA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 35-163 aa of BC047455 Sequence: NRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDAGECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRGDNDLDPDECMQRTGGLFGSRRPVLSGTGNGDT Predict reactive species\nFull Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 4\nCalculated Molecular Weight: 690aa,76 kDa; 724aa,79 kDa\nObserved Molecular Weight: 79 kDa\nGenBank Accession Number: BC047455\nGene Symbol: DDX4\nGene ID (NCBI): 54514\nRRID: AB_2092998\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NQI0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868884127913,"sku":"51042-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-51042-1-ap","provider":"Iright","version":"1.0","type":"link"}