{"product_id":"proteintech-60034-3-ig","title":"Proteintech, 60034-3-Ig, Neprilysin\/CD10 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Neprilysin\/CD10 (60034-3-Ig) by Proteintech is a Monoclonal antibody targeting Neprilysin\/CD10 in WB, IHC, ELISA applications with reactivity to human, mouse, pig, rabbit samples\n60034-3-Ig targets Neprilysin\/CD10 in WB, IHC, ELISA applications and shows reactivity with human, mouse, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, Daudi cells,  HEK-293 cells,  mouse kidney tissue,  pig kidney tissue,  Ramos cells,  A172 cells,  rabbit kidney tissue\nPositive IHC detected in: human kidney tissue, human liver tissue,  human renal cell carcinoma tissue,  human stomach cancer tissue,  human tonsil tissue,  mouse kidney tissue,  mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:25000-1:100000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD10, also known as neprilysin, membrane metallo-endopeptidase (MME), neutral endopeptidase (NEP), or common acute lymphoblastic leukemia antigen (CALLA), is a 100-kDa type II transmembrane glycoprotein belonging to peptidase M13 family (PMID: 7760013; 8102558). Among hematopoietic cells, CD10 is expressed on granulocytes, B cell precursors, mature germinal center B cells, a subset of immature thymocytes (PMID: 13679451). CD10 is also expressed on a variety of nonhematopoietic cell types, including bronchial epithelial cells, cultured fibroblasts, bone marrow stromal cells, renal proximal tubular epithelial cells, breast myoepithelium, biliary canaliculi (PMID: 8102558). CD10 is a cell surface peptidase that cleaves peptide bonds on the amino side of hydrophobic amino acids and inactivates a variety of physiologically active peptides. Loss or decreases in CD10 expression have been reported in a variety of malignancies (PMID: 16054017).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, pig, rabbit\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag0427 Product name: Recombinant human MME,CD10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 52-252 aa of BC101658 Sequence: YDDGICKSSDCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKEACTAYVDFMISV Predict reactive species\nFull Name: membrane metallo-endopeptidase\nCalculated Molecular Weight: 750 aa, 86 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC101658\nGene Symbol: CD10\nGene ID (NCBI): 4311\nRRID: AB_10641991\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P08473\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888302575785,"sku":"60034-3-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-60034-3-ig","provider":"Iright","version":"1.0","type":"link"}