{"product_id":"proteintech-60043-1-ig","title":"Proteintech, 60043-1-Ig, SLAM\/CD150 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLAM\/CD150 (60043-1-Ig) by Proteintech is a Monoclonal antibody targeting SLAM\/CD150 in WB, ELISA applications with reactivity to human samples\n60043-1-Ig targets SLAM\/CD150 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MJ cells, HUVEC cells,  Jurkat cells,  Raji cells,  Daudi cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSignaling lymphocytic activation molecule (SLAM, also known as SLAMF1 or CD150) is a 70-95 kDa transmembrane glycoprotein that belongs to the immunoglobulin gene superfamily. SLAM is constitutively expressed on peripheral blood memory T-cells, T-cell clones, immature thymocytes and a proportion of B-cells, and is rapidly induced on naive T-cells after activation. SLAM is involved in T cell stimulation and cytokine production, and may play an important role in the regulation of immune responses to pathogens.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: monkey\nHost \/ Isotype: mouse \/ IgM\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag1386 Product name: Recombinant human SLAMF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC012602 Sequence: MDPKGLLSLTFVLFLSLAFGASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKSLHFGYLYFVLGADHDNLQT Predict reactive species\nFull Name: signaling lymphocytic activation molecule family member 1\nCalculated Molecular Weight: 37 kDa\nObserved Molecular Weight: 80 kDa\nGenBank Accession Number: BC012602\nGene Symbol: CD150\nGene ID (NCBI): 6504\nRRID: AB_2187821\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Thiophilic affinity chromatograph\nUNIPROT ID: Q13291\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888075690153,"sku":"60043-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-60043-1-ig","provider":"Iright","version":"1.0","type":"link"}