{"product_id":"proteintech-60076-1-ig","title":"Proteintech, 60076-1-Ig, SULT1A1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SULT1A1 (60076-1-Ig) by Proteintech is a Monoclonal antibody targeting SULT1A1 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples\n60076-1-Ig targets SULT1A1 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig brain tissue, human placenta tissue,  human liver tissue,  Jurkat cells,  U2OS cells,  HepG2 cells,  HEK-293 cells,  rat brain tissue,  mouse brain tissue,  mouse liver tissue,  rat liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:5000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSULT1A1, also named as ST1A1, P-PST 1, ST1A3, Ts-PST, P-PST 1, STP and STP1, belongs to the sulfotransferase 1 family. It catalyzes the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. SULT1A1 is also responsible for the sulfation and activation of minoxidil. It mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk. SULT1A1 is one of two phenol sulfotransferases with thermostable enzyme activity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag4611 Product name: Recombinant human SULT1A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-295 aa of BC000923 Sequence: MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL Predict reactive species\nFull Name: sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1\nCalculated Molecular Weight: 34 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC000923\nGene Symbol: SULT1A1\nGene ID (NCBI): 6817\nRRID: AB_2197592\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P50225\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888077000873,"sku":"60076-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-60076-1-ig","provider":"Iright","version":"1.0","type":"link"}