{"product_id":"proteintech-60123-1-ig","title":"Proteintech, 60123-1-Ig, CXCL16 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CXCL16 (60123-1-Ig) by Proteintech is a Monoclonal antibody targeting CXCL16 in WB, ELISA applications with reactivity to human samples\n60123-1-Ig targets CXCL16 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HaCaT cells, SH-SY5Y cells,  Calu-3 cells,  A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCXCL16 is a recently discovered cytokine belonging to the CXC chemokine family, which is synthesised in plasmacytoid dendritic cell as a transmembrane molecule. It exists in a transmembrane and soluble form. The transmembrane form of CXCL16 functions as an adhesion molecule for CXCR6-expressing cells, whereas the soluble form of CXCL16 mediates infiltration of circulating cells into sites of injury. CXCL16, has been proposed as an important pathogenic mediator in inflammatory diseases, including rheumatoid arthritis, glomerulonephritis, or prostate cancer. CXCL16 has been implicated in some forms of renal disease such as lupus nephritis and antiglomerular basement membrane nephritis. CXCL16 also plays a pivotal role in the pathogenesis of angiotensin II-induced renal injury and fibrosis through regulation of macrophage and T cell infiltration and bone marrow-derived fibroblast accumulation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag4883 Product name: Recombinant human CXCL16 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 46-225 aa of BC017588 Sequence: GNGNEGSVTGSCYCGKRISSDSPPSVQFMNRLRKHLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLPTSPPISQASEGASSDIHTPAQMLLSTLQSTQRPTLPVGSLSSDKELTRPNETTIHTAGHSLAAGPEAGENQKQPEKNAGPTARTSATV Predict reactive species\nFull Name: chemokine (C-X-C motif) ligand 16\nCalculated Molecular Weight: 273 aa, 30 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC017588\nGene Symbol: CXCL16\nGene ID (NCBI): 58191\nRRID: AB_2086188\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9H2A7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887997833385,"sku":"60123-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-60123-1-ig","provider":"Iright","version":"1.0","type":"link"}